OuterStats is here to display any thing is needed for www.meubella.nl. We seek and locate Meubella.nl information for inquirer. We will show you Meubella value, date of creation, location, hosted server, local language and estimated data - The estimated data is a special algorithm built by us to demonstrate www.meubella.nl worth.

Meubella | Meubels voor de laagste prijs! | Meubella

Meubella | Groot aanbod designmeubels | Veel voorraad en een uniek assortiment. Bekijk onze hoekbanken, boxsprings en bedden. Met laagste prijsgarantie!

Meubella.nl was created on the unknown, domain is hosted in ip:, and owner of this ips: . Our algorithm estimates Meubella.nl worth to be about $6,727 and estimates that it gets about 1,684 visits per day. Meubella.nl is located in Netherlands. Meubella.nl using nginx/1.2.1 server and powered by unknown.

Created: unavailable

Expires: unavailable

Owner: unavailable

Hosted in: Netherlands

Host IP:

ICANN Registrar: Stichting Internet Domeinregistratie NL

Domain Archive: meubella.nl in the past

Alexa Rank: #593845

Google Page Rank: 0

Server DNS A:

Server DNS NS: ns2.flexwebhosting.nl ns1.flexwebhosting.nl ns3.flexwebhosting.com

Server Name: unavailable

Server Type: nginx/1.2.1

Server Side Language: unavailable

meubella.nl - Daily Traffic Rank Trend In The Past 4 Months

Keyword Count Density
Meubella 14 3.37
Gmt 5 1.2
Voorraad 5 1.2
Meubels 5 1.2
Aug 4 0.96
Laagste 3 0.72
Wit 3 0.72
Designmeubels 3 0.72
Rsaquo 3 0.72
Zoek 3 0.72
Klantenservice 3 0.72
Overigsalontafelsbureauskapstokkenslaapkamerbekijk 2 0.48
Beddeneenpersoonsbeddentweepersoonsbeddenboxspringshoofdbordenlattenbodemsmatrassenbekijk 2 0.48
Slaapkamerbeddenbekijk 2 0.48
Kamerscomplete 2 0.48
Meubelsvitrinekastenwandplankenwandmeubelsboekenkastenbuffetkastenkastenoverigbekijk 2 0.48
Verlichtingbinnenverlichtingbekijk 2 0.48
Complete 2 0.48
Kamersbekijk 2 0.48
Kastencommodesgarderobekastennachtkastjescomplete 2 0.48
Matrassenkoudschuimmatrassenpocketveringmatrassenlatexmatrassentopdekmatrassenhoofdkussenskastenbekijk 2 0.48
Header Key Header Value
Server nginx/1.2.1
Date Wed, 31 Aug 2016 07:58:18 GMT
Content-Type text/html
Content-Length 184
Connection keep-alive
Location http://www.meubella.nl/

We believe that every website pwner is able to earn money from his website.

Our estimations point that your Website Worth is $6,727.38, Your Daily Visitors could be in the area of 1684 per day and your estimated Daily Revenues could be around $5.05.

Server Country Code: NL

Server Country Name: Netherlands

Server City Name:

Server Region Name:

Server Zip Code:

Server Latitude: 52.36669921875

Server Longitude: 4.9000000953674

feubella.nl, meubella.nl, yeubella.nl, mdubella.nl, melbella.nl, merbella.nl, meufella.nl, meuuella.nl, meuzella.nl, meubplla.nl, meubulla.nl, meubetla.nl, meubelka.nl, meubelpa.nl, meubelxa.nl, meubelle.nl, meubellp.nl, meubellapnl, meubellaqnl, meubellarnl, meubella.yl, meubella.zl, meubella.nc, meubella.ni, meubella.nj, meubella.nl, meubellan.l, meubella.ln, ameubella.nl, dmeubella.nl, wmeubella.nl, mjeubella.nl, meyubella.nl, meulbella.nl, meumbella.nl, meuzbella.nl, meubnella.nl, meubqella.nl, meubwella.nl, meubyella.nl, meubeilla.nl, meubeulla.nl, meubelqla.nl, meubellca.nl, meubellla.nl, meubelloa.nl, meubellqa.nl, meubellza.nl, meubellao.nl, meubella.rnl

Domain name: meubella.nl
Status: active

Flexwebhosting BV
Doctor Cuyperslaan 76


Domain nameservers:

Record maintained by: NL Domain Registry

Copyright notice
No part of this publication may be reproduced, published, stored in a
retrieval system, or transmitted, in any form or by any means,
electronic, mechanical, recording, or otherwise, without prior
permission of the Foundation for Internet Domain Registration in the
Netherlands (SIDN).
These restrictions apply equally to registrars, except in that
reproductions and publications are permitted insofar as they are
reasonable, necessary and solely in the context of the registration
activities referred to in the General Terms and Conditions for .nl
Any use of this material for advertising, targeting commercial offers or
similar activities is explicitly forbidden and liable to result in legal
action. Anyone who is aware or suspects that such activities are taking
place is asked to inform the Foundation for Internet Domain Registration
in the Netherlands.
(c) The Foundation for Internet Domain Registration in the Netherlands
(SIDN) Dutch Copyright Act, protection of authors' rights (Section 10,
subsection 1, clause 1).

Recent Analyzed Websites

Recent Visited Websites